PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bradi1g20250.2.p
Common NameBRADI_1g20250, LOC100822592
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
Family MYB
Protein Properties Length: 322aa    MW: 33289.2 Da    PI: 6.7657
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bradi1g20250.2.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding543.9e-171663148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
   Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                      rg W++eEde+l++ ++++G+g+W+++++  g+ R++k+c++rw +yl
  Bradi1g20250.2.p 16 RGLWSPEEDEKLLNHIAKFGNGCWSSVPKIAGLERCGKSCRLRWINYL 63
                      788*******************************************97 PP

2Myb_DNA-binding52.21.4e-1669114148
                       TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
   Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                       rg+++++E+el++ ++ +lG++ W+ Ia+ ++ gRt++++k++w+++l
  Bradi1g20250.2.p  69 RGAFSQQEEELIISLHSLLGNK-WSQIAAQLP-GRTDNEVKNFWNSFL 114
                       89********************.*********.************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129418.5661163IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.9E-241166IPR009057Homeodomain-like
SuperFamilySSF466894.49E-2913110IPR009057Homeodomain-like
SMARTSM007173.2E-131565IPR001005SANT/Myb domain
PfamPF002499.3E-161663IPR001005SANT/Myb domain
CDDcd001675.57E-121963No hitNo description
PROSITE profilePS5129426.15264118IPR017930Myb domain
Gene3DG3DSA:1.10.10.606.4E-2667118IPR009057Homeodomain-like
SMARTSM007172.1E-1568116IPR001005SANT/Myb domain
PfamPF002497.4E-1569113IPR001005SANT/Myb domain
CDDcd001675.53E-1171114No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 322 aa     Download sequence    Send to blast
MAKRPAGGGT KKRLRRGLWS PEEDEKLLNH IAKFGNGCWS SVPKIAGLER CGKSCRLRWI  60
NYLRPDLKRG AFSQQEEELI ISLHSLLGNK WSQIAAQLPG RTDNEVKNFW NSFLKKKLRA  120
RGIDPATHKP LVSNLSPAPV FSDAAAELGL PASMAPPPPM PPLGVASAAA ESACCYVYGG  180
SSDCGGGGHG FMIPSVSSSS TLSSMAAGGA AAATEEQYSG GGFESSVTTQ SSGGGGGAQL  240
PWLELGGSIS SYGGAGAGDE EQYGAALDEL RWSDYVFDGG YQDQQCAAAA IYDHGKAGGD  300
PAATAAQSFG AHGGGVSWCL N*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C4e-281411825128MYB TRANSFORMING PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK3537851e-125AK353785.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv1002L23.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003559914.10.0PREDICTED: myb-related protein Hv33-like
TrEMBLI1GRY50.0I1GRY5_BRADI; Uncharacterized protein
STRINGBRADI1G20250.10.0(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP30923385
Representative plantOGRP5171784
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G26660.18e-61myb domain protein 86